DPCstruct | MC36972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 128 |
|---|---|
| Mean domain length (aa) | 148 ± 28 aa |
| Standard deviation of domain lengths | 28.45 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 32.81 |
| Pfam Score | 76.45 |
| Assigned Pfam label(s) | CL0031- PF12368 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K2C169 | 15-148 | MDYYEQFKDKKIVMYCTRGVRCESATALFVQYGFDKKNVYHLEGGIVKYAEKYGNEGFFEGKCFTFDDRIALVVNTSDTAVILGNCA… |
| A0A1E3GU86 | 1-112 | MFCTGGIRCEKSTAYLKEQGFEEVYHLEGGILKYLEDVPEQESLWEGECFVFDERVTVNHSLEKGEYDQCHACRLPITEEDKQSEKY… |
| A0A5B6YM78 | 43-212 | None |
| A0A1R3KN60 | 87-238 | None |
| A0A812NLV7 | 408-547 | None |
| A0A3L7PDC7 | 148-269 | None |
| A0A4P9Y0Z8 | 173-319 | None |
| A0A7S3FTL5 | 162-321 | None |
| C1N3F0 | 362-508 | None |
| A0A2N9GKS0 | 204-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.