DPCstruct | MC36971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 63 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453Q949 | 173-232 | TGAHVSTASNVYSFGIVLLEIFLRKRPTDDMFKDGLDIAKFVEVHYSSKVSQIVDPELLQ |
| A0A6V7QJ73 | 124-179 | MGAKVSKEGDVYSYGVLLLEMLTGKRPTNEMFKDGLSLHKFVSMAFPERVEDILDH |
| A0A6P8C6P0 | 682-736 | None |
| A0A453DL41 | 215-286 | None |
| A0A0A9DC69 | 11-71 | None |
| A0A5B7CFT7 | 45-112 | None |
| B9HLF9 | 3-67 | None |
| A0A4V3WJW1 | 930-987 | None |
| B8BJC3 | 162-229 | None |
| A0A6J0PQJ8 | 483-537 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.