DPCstruct | MC36969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 143 ± 26 aa |
| Standard deviation of domain lengths | 25.85 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.28 |
| Pfam Score | 98.72 |
| Assigned Pfam label(s) | PF03759- PF00504 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453Q4D6 | 18-170 | MWNREMDCLLSICEYIVEFAPTVQARPDGSTHDVMATSPRSDILMNLPALEKLETMLLGILDSFDKAEFWYADQRKQSFTETKKPSS… |
| A0A3P5YR46 | 1-100 | MTPKPRADIHMNLPALRKLDSMLIETLDSMVNTEFWYSEVGPRAEESRRWWLPSPKVPKPGLSSLVRKNLLEKGNVVYQSFKAAKSI… |
| A0A1D6PWZ1 | 118-220 | None |
| A0A830C305 | 43-195 | None |
| A0A0E0JR22 | 70-271 | None |
| A0A835RGH6 | 138-290 | None |
| A0A445DD76 | 196-360 | None |
| A0A446Q002 | 43-191 | None |
| A0A5D2TNM5 | 232-385 | None |
| A0A5P1ET14 | 178-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.