DPCstruct | MC36967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 48 ± 1 aa |
| Standard deviation of domain lengths | 0.53 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 85.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 83.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453Q106 | 1-49 | MFGVCLLADNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASAANAIV |
| A0A556UZW7 | 291-338 | GVFLYFEDNAGVIVNNKGEMKGSAITGPVAKECADLWPRIASNAGSIA |
| A0A812VC18 | 289-336 | None |
| A0A2G3C432 | 78-124 | None |
| G7I8D0 | 118-165 | None |
| A0A0E0M8I0 | 255-302 | None |
| A0A2K2AVR0 | 57-105 | None |
| A0A507ERP1 | 123-170 | None |
| A0A1Y3B4K5 | 600-647 | None |
| A0A163J5G9 | 139-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.