DPCstruct | MC36964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 162 ± 16 aa |
| Standard deviation of domain lengths | 15.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 56.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453PVG1 | 1-138 | RSCLDENKAFLSTADSAVKLLTDATKPISGWKGLEYRAAFPLDKPRGANFYPADMNKMEFDLWKSGLTDKEQKDATGFFTVIKRPDA… |
| A0A1R0H2A2 | 417-533 | KPFLPHIPSKPPGANLYPEDMSKDEFNDWCSSLPPSELKKARGFYTKITRDSADGGKLKYMPYSEAYSHLLQQAASLLSQASALVSN… |
| A0A2U1M4I2 | 63-222 | None |
| A0A438JX41 | 4-178 | None |
| A0A218XP48 | 368-534 | None |
| A0A2G5D0R5 | 279-450 | None |
| B9RGQ2 | 273-439 | None |
| A0A3N7GNP8 | 96-266 | None |
| A0A4S8IV71 | 202-371 | None |
| A0A446WPR5 | 129-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.