DPCstruct | MC36962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 218 ± 31 aa |
| Standard deviation of domain lengths | 30.60 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.47 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF12896- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453PTM7 | 3-231 | KMLRSIKSHDVAIICLNWAEDEPLSRTDKEDLLSYEDRTTRFFPPAPVMPRIGGLNSGDTGLADENEEAIQAFSSASCQRFNILCTG… |
| A0A446WP02 | 1-184 | MPRIGGLNSGDTGLADENEEAIQAFSSASCQWFNILSTGDKDGCICFSIFGIFPVGKININKVPIHVQSSGKRTSYRLQDVSISKVS… |
| A0A0G4NN66 | 1-264 | None |
| A0A183QG77 | 171-390 | None |
| A0A0B7N6U2 | 106-302 | None |
| A0A5N6K3D6 | 563-802 | None |
| A0A059CJH8 | 9-167 | None |
| A0A5M8PRF8 | 117-341 | None |
| A0A0J8REJ0 | 125-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.