DPCstruct | MC36961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 178 ± 32 aa |
| Standard deviation of domain lengths | 32.32 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 31.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6SLF0 | 25-159 | PTEMVFKLLYYLLWPFSRSALEVVRLLAQKTKEVEFEFFKYVKEQKLVELAGLLLVAHEKVMPGLEERMKIRNFVLKEAAFLNLQEI… |
| A0A453PL60 | 59-214 | PTPKKIFLDTVRLLAERTDNLVDEIWNYVKDGKLVQSAVLLLSAQAQIRGGCSSKRNGNNKRDGFDIIMCHIVRHLVTLRSENKNTN… |
| A0A484M7A2 | 79-323 | None |
| A0A1R3JH95 | 267-417 | None |
| A0A1R3K272 | 130-275 | None |
| A0A446M044 | 215-413 | None |
| M7Y5M6 | 147-300 | None |
| T1MIB0 | 206-361 | None |
| B9FXI1 | 211-371 | None |
| A0A484N3E5 | 21-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.