DPCstruct | MC36960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 202 ± 27 aa |
| Standard deviation of domain lengths | 26.75 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453PJP6 | 17-198 | VDESLAQVCSESGALDPLMNMYVERMQATTKKWYTNILEADKTQPPKSTEDGKLYTPAAVDLFRILTEQVQIVRDNSTDVMLYRIAL… |
| A0A1D6HKJ6 | 86-289 | TGWVVQYQENLIGLGVDESLAQVCSESGALDPLMNMYVERMQATTKKWYSNILEADKTQPPKSTEDGKLYTPAAVDLFRILTEQVQI… |
| A0A1R1WYJ8 | 399-585 | None |
| A0A0V0U835 | 239-487 | None |
| A0A453G2V6 | 87-278 | None |
| A0A7S0HQ90 | 17-200 | None |
| A0A7S2S3J8 | 381-560 | None |
| A0A2N5V2S7 | 4-211 | None |
| A0A2I0TD63 | 1-220 | None |
| A0A812RMU5 | 8-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.