DPCstruct | MC36959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 100 ± 14 aa |
| Standard deviation of domain lengths | 13.95 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 55.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453PJ48 | 19-109 | TANHRNIVRMPVVMRELWLEMWHDMHPHSKSKFVTKAFRGPLRHEDCHWDYAKARCAFPEFCEYRYTFGDVHLGMSCRLKYSSTKLL… |
| A0A1J3E2N0 | 258-367 | FYEDSESIPGKRTAVWELDKANHRNIVRSPVLMRELWLQMWHDIQPGVKAKFVTKAKRGPLRDADCYWDYGKACCAWQEYCEYRYSF… |
| A0A7C9AWM0 | 7-112 | None |
| A0A080Z384 | 306-404 | None |
| A0A3Q7XNS2 | 439-548 | None |
| F0XXQ8 | 476-594 | None |
| A0A287UPF2 | 212-314 | None |
| A0A287UPF9 | 25-135 | None |
| A0A446WKI6 | 89-198 | None |
| A0A7S2X746 | 68-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.