DPCstruct | MC36958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 4.35 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 72.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287W8S5 | 178-245 | AAASGRSMVKYEGGYAVETVFDGSSLGIEPHSVEVTPAGDLLLLDSMNSNLYRVQLPLSRYSRPKLVA |
| A0A445F7C6 | 1-66 | MRFNEEVIGAKSMMKFESGYSVEIMFDGSKLGIEPYAVEVLPNGELLILDSTNSNVYRISSSLSLS |
| A0A087G1R6 | 29-84 | None |
| A0A803L0G3 | 511-575 | None |
| A0A287W9A9 | 188-245 | None |
| A0A4S8J7V9 | 1-55 | None |
| A0A453FKD1 | 28-87 | None |
| A0A453FKA6 | 58-117 | None |
| A0A1D6HJ70 | 64-131 | None |
| A0A835Q791 | 300-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.