DPCstruct | MC36956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 72 ± 3 aa |
| Standard deviation of domain lengths | 3.16 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 73.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0190 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U8Q6D8 | 107-174 | MVVDVGPSADWVKINVRKTKDCFEVYALVPWLLREEVHVQSDLAGRLVISGESEQLDNPWGVTPFKKV |
| A0A453PEH7 | 1-75 | MVIDVGEPADWVKINVRQTKECFEIYALVPGLLREEVHVQSDPAGRLVITGDPDQPDNPWGITAFKKGDQLAVKD |
| A0A1U8AT61 | 19-91 | None |
| A0A2R6XI97 | 376-445 | None |
| M1E0N1 | 196-269 | None |
| A0A7N0T032 | 10-80 | None |
| A0A453PEM2 | 225-298 | None |
| A0A833QUZ4 | 325-402 | None |
| A0A2P5BMM6 | 410-477 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.