DPCstruct | MC36955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 144 ± 20 aa |
| Standard deviation of domain lengths | 20.09 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.13 |
| Pfam Score | 69.05 |
| Assigned Pfam label(s) | CL0023- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453PDZ9 | 2-157 | LKMLTPDIDPIPPEVLTEFNLANLFDAYMGIHKPKNRDEADFARRRLIFDDFFYLQLGRLFQMLEAVGTRVEKEELLYKCENHELNA… |
| A0A7V3AUC5 | 91-238 | IREKISLVLKNEIWRAREFLPEKILKKLNLVPLKEAILKIHFPETKEDIKISRFRFAFEELFLLEIEVLREKLKVKKKRAYPLKIQV… |
| A0A0G0JDL7 | 159-310 | None |
| A0A447N1R7 | 6-149 | None |
| A0A453PDT3 | 132-319 | None |
| R5T3G2 | 102-249 | None |
| A0A4D4LNA8 | 154-297 | None |
| A0A5B8MXD2 | 726-876 | None |
| E4LJR9 | 165-314 | None |
| A0A377LPP9 | 84-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.