DPCstruct | MC36954
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 78 ± 2 aa |
| Standard deviation of domain lengths | 2.25 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 83.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 63.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453BRK3 | 11-87 | ALGYSVVVSFKRTSRTVKRDQLLIAAETIDSLNESFLVLKGPSRKIVAAEASNLGIKGPWITKSYLEMILESKGVPR |
| A0A2R6QI75 | 1-80 | MALGYTIASILKRSSHVFFDDRVCVKTDWLEQLNRKYVQVQGRDRMYVKFIAEQLGLDGSYVPRTYIEQIQLEKLVNDVM |
| A0A453BRR4 | 64-142 | None |
| A0A287I8X1 | 61-139 | None |
| M1BKL3 | 61-136 | None |
| Q9ZVF8 | 314-395 | None |
| A0A287I8T4 | 64-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.