DPCstruct | MC36953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 103 ± 20 aa |
| Standard deviation of domain lengths | 20.47 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 46.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04759 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6XAG0 | 150-241 | EPIWSMFCNGRKTGYAIRRMFSEFDRHILTVVQAVSMGAGVLPMEEESSDGELMYMRARFERVIGSRDSEAFYMMNPDGSGGPELSI… |
| A0A453PDB0 | 179-274 | EEPTWRAYCNGLKCGYAVHRECGADEWRVLGAVEQVSVGAGVLPDDGAAGGAGEGDLMYMRAKFERVVGSRDSEAFYMMNPDGSGGP… |
| A0A0Q3U1L0 | 4-70 | None |
| A0A3N7GDF9 | 64-161 | None |
| A0A0Q3PDL4 | 138-231 | None |
| A0A834TTL1 | 27-120 | None |
| M4CKA0 | 153-259 | None |
| A0A5A7QN15 | 38-117 | None |
| A0A3L6PR90 | 33-129 | None |
| A0A834Z522 | 616-712 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.