DPCstruct | MC36951
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 127 ± 9 aa |
| Standard deviation of domain lengths | 9.39 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 55.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848I2A9 | 147-281 | AQDHDLAVADAHAGALPLCRTMERLRHTRLLQRAQLRTWIARGLEVGQVAGAGHIRWGKAISGLTGRLGEFTARYAGPAQPRGHRIV… |
| T0I713 | 1-138 | MERTRNTALQQRTHFRIWLDRGFLAGQTVGAGHIRWGKAVNGLTGRLGEFTARYAGKLPPRGHRIVIETADGKPAAGFVTARGEPLA… |
| A0A2Z6AP27 | 112-232 | None |
| A0A1W7M6K4 | 191-308 | None |
| G2ITA5 | 35-148 | None |
| S3FFL3 | 437-559 | None |
| A0A1T5GLK0 | 310-447 | None |
| A0A520FA05 | 244-381 | None |
| A0A4Q2X4V1 | 80-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.