DPCstruct | MC36945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 156 ± 14 aa |
| Standard deviation of domain lengths | 14.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8VA78 | 148-296 | FEESVLILEAPEAGANVSVFVTQNFVTVVNNDNGQIISRQSQDEVSRVILVGSNTSADTVNLFMANGQGSLEHGIELYGCDSADDVL… |
| A0A4R0KS74 | 1-149 | MFNGSAAAEKFVAAANGPRLRFTRDVGNIVMDTDNVERVSLNALGGADTVAVGDLRGTDVKNVDVDLGAQLNASGGDSAVDAVTVTG… |
| A0A3B9MKI6 | 49-211 | None |
| A0A518JY26 | 704-867 | None |
| A0A535J9G7 | 33-184 | None |
| A0A1G3AG41 | 1079-1235 | None |
| A0A3E0PMX2 | 479-641 | None |
| A0A5C8PHL0 | 316-454 | None |
| Q7UFE7 | 383-543 | None |
| A0A5B9PPA6 | 752-909 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.