DPCstruct | MC36942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 197 ± 37 aa |
| Standard deviation of domain lengths | 36.87 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 33.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0WVD8 | 565-761 | ASQKIQNCWKSYRSRQQFQYYSSLLKFENTGDPIAILRAINPVEAKFLDASMSAHVRFRLGGFQFPPTIYYKIFTRSPICDLNAFSP… |
| A0A5F8GGQ8 | 10-219 | FPYSIEQTQAAQVIQRAWFSHMDRMMFQLLKHTICAAENCVTHEILKKVCPLEADLVKDPSVQCKVRFRFGGKTFPPFIVFKIFLHT… |
| A0A177WVK9 | 35-264 | None |
| A0A1S8W5P6 | 34-194 | None |
| A0A7S1KQK3 | 208-437 | None |
| A0A4X2LAD4 | 19-204 | None |
| A0A507EF28 | 336-571 | None |
| A0A813RFF3 | 21-271 | None |
| A0A1Y2C8N8 | 210-383 | None |
| A0A4Z2GWW4 | 30-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.