DPCstruct | MC36940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 7.21 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0WJJ4 | 8-106 | QFAEGASGYPLSEDIKVDVLSHHLEETTERYYNQQLEGLWKEQPDLEHAMQCLLHTIAPKVTPVQSMKIFAATKSPARSWTEHYLHL… |
| A0A225W5I8 | 102-194 | NIAQSACGFPWPKDVKVDLFGHYMAGTAANYFNKQVDAWWAQLPTLQYVMEKMLETFKTTITPAQAMKLFTATKDPKRSWPEHYMYL… |
| M4BWJ9 | 46-141 | None |
| A0A6A3QVW4 | 8-106 | None |
| A0A6G0RW70 | 1-98 | None |
| A0A2P4YMY5 | 244-339 | None |
| A0A6A3UQI3 | 3-96 | None |
| F0WMD6 | 139-243 | None |
| F0WI69 | 4-84 | None |
| D0N8A9 | 187-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.