DPCstruct | MC36939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 242 ± 34 aa |
| Standard deviation of domain lengths | 34.19 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2Q4G9 | 3-203 | NAVPPTFSSKKESHLAPMASSNSSSLGAEMTAPDNVTTSGDSCTWYAGESCEKSRTCYDCLNVGIVGDSCAVGVFGQCLSISEQITG… |
| F0WGK5 | 19-250 | GATCMYYGLEIGAACRKPRTCFDCLNAVAERELEGCVLTSNGICKSIAAYIPQLDYRRIRDRTYPSVTYFPSVNSTYCVANDPACVE… |
| A0A5D6Y9L3 | 273-515 | None |
| A0A2P4XK38 | 63-312 | None |
| A0A0P1AF72 | 13-243 | None |
| A0A662WKZ3 | 14-230 | None |
| A0A662WGY3 | 175-383 | None |
| K3X0P9 | 8-200 | None |
| K3WQ11 | 23-285 | None |
| A0A5D6Y9M2 | 27-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.