DPCstruct | MC36935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 121 ± 19 aa |
| Standard deviation of domain lengths | 18.77 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0W0W6 | 56-200 | RANLGGMERGNHDSMTNSSKRARRHAWQSKYEMDFGLIAIERDAVTDDVTLAMCGFCKAFGREGKYEQLIQETESSMDTKKRRRRSL… |
| W2QDI0 | 1-94 | MGTTKPPAFKSKHTVKYGLKVSARAPGSSKVTSVICRFCSRFGREDKPNAQHKASSRHKVYQKFLPYLYESDNKGQHPIKWAEYTVV… |
| A0A5D6XWP2 | 14-127 | None |
| A0A067CSY2 | 1-119 | None |
| A0A1V9ZQ01 | 1-109 | None |
| A0A081APP9 | 16-132 | None |
| A0A6G0XN10 | 3-92 | None |
| A0A1V9YCR9 | 1-100 | None |
| A0A5J4YYN9 | 249-368 | None |
| A0A2R6XCM8 | 2-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.