DPCstruct | MC36930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 283 ± 67 aa |
| Standard deviation of domain lengths | 66.91 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 69.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 14.58 |
| Pfam Score | 48.53 |
| Assigned Pfam label(s) | CL0023- CL0604- PF12168- PF12170- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847WCA9 | 27-252 | YMSGKDVAEVLNQLANLHRDLLLMQIAPKGGGSLLSGSFTDASLKELGNLVKRDKLFMALSDLQETLSKLSRSSDRKLTAELCLLRL… |
| A0A1G2WEZ0 | 5-212 | ELKAAFQVSPRIAALVGAAAAADPASVTPADLARVAAAVDDLLPERERNNDQTFAWALKRHGVRAIAMLAIAIEDPDVRSPCKYFGR… |
| A0A3E1E9A8 | 33-359 | None |
| A0A833FYC8 | 65-298 | None |
| A0A7V3GTX6 | 225-546 | None |
| A0A1Z3HM32 | 554-841 | None |
| A0A1Z4JFA6 | 742-1028 | None |
| A0A5P1F914 | 612-942 | None |
| A0A220VED2 | 158-620 | None |
| A0A7W1TS10 | 84-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.