DPCstruct | MC3693
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 6.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N3FY63 | 33-111 | DSGWTFVSIGVEGDPVDLGAGLNPWDHGWRSTGRRVVVAHPSYPWQRHDMYEWTLDGVEPAVRFAAGEYSYGVWGFFVP |
| A0A3S3R4S0 | 1-81 | MSISKDWEFVKVVTDGEPFFINGVGIWENEWKNTDQSIYILDPVYHRPYTLPIYEISADGKTITFAATEFSNCVWGVYIPV |
| A0A419VUA6 | 1-71 | None |
| A0A5C5UXH2 | 97-195 | None |
| A0A4R2NJM6 | 2-79 | None |
| A0A2W2C188 | 9-85 | None |
| A0A1G6ZXG7 | 8-87 | None |
| A0A316Q7W4 | 3-98 | None |
| A0A3D0JH20 | 2-78 | None |
| D5BHC9 | 2-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.