DPCstruct | MC36925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 279 ± 28 aa |
| Standard deviation of domain lengths | 28.33 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813FJI1 | 1-275 | MTAASFMGRFTGSLLLRACGLCLLMAKVQTATAAASVEACMDAHDQGIWTSTGSRSFSSLSTTCGRKCFGAAECSAQCIQSANDGGY… |
| A0A813H9B1 | 1-245 | MAFTVAAAMLAFLGYAVGSPEGSALQNTTGACGGDSDQQIWRSGGKYTFGGAATHCGRRCYYSAGCSAVCLAYQEGYSAKCSSCMGS… |
| A0A813JZW2 | 488-766 | None |
| A0A812SA23 | 1-328 | None |
| R1BTZ9 | 1-300 | None |
| A0A813IQQ1 | 1-233 | None |
| A0A7J6MWU3 | 14-291 | None |
| A0A7J6P8B8 | 1-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.