DPCstruct | MC36924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 116 ± 8 aa |
| Standard deviation of domain lengths | 7.81 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 52.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A068UU27 | 137-257 | KEGVNHFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFAYGPDTYFGNEVSVVEMDGQFDRLDELIYVESHLSNISSKFYGEVTQQML… |
| A0A813FI27 | 1-103 | MITLKKELTLTGSKSGATLKQYDMDWMGSPATVVEMDGEIDMDNMEKQVEEIEANIVGLAGSPNELRDAMVKLKTSPGSQNGTGLLQ… |
| A0A7S4R5K1 | 50-158 | None |
| A0A2P5X0W5 | 231-350 | None |
| Q5ENS2 | 301-411 | None |
| C0P2M2 | 1-122 | None |
| A0A7R9ZPS4 | 208-326 | None |
| R7QGF6 | 251-367 | None |
| A0A812W586 | 788-899 | None |
| A0A813IES4 | 683-789 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.