DPCstruct | MC36920
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 7.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 57.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9FQG3 | 1-74 | MQDPVYSPFFGIMGASASIVFSALGAAYGTAKSGIGISAMAVTKPEMIMKSLIPVVMAGIIGIYGMVVAILIAG |
| A0A1R1Y728 | 1-80 | MSQIVHDYCPVYSPFFGAMGCVAATVFCSFGAAYGTAKSGVGLSAMGILRPDLVIKNIVPVVMAGIIGIYGLVVAVLISD |
| M7W2T0 | 14-86 | None |
| A0A409X439 | 1-90 | None |
| A0A1I7YC21 | 34-115 | None |
| A0A812VSN3 | 62-154 | None |
| A0A813FI33 | 313-384 | None |
| A0A671UDK7 | 1-77 | None |
| A0A151HQL2 | 6-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.