DPCstruct | MC3692
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 133 ± 25 aa |
| Standard deviation of domain lengths | 25.31 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0231 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9GL56 | 6-129 | YADVLKFHETFGHTVHDKPQIPKRSDVLLRAVVTRDEFNNEYLPALLHGDIKHIADDGIDLIYFIIGTFITYGIDPQPIWDAVQAAN… |
| A0A5N7RPS5 | 10-152 | HRTPVREFHEAFGHPVFCEPTVPSLDQRILRIRMLAEELTELCAAAGVTLRITPTWCGTHDIEARGISAETCDLVECADALGDLRYL… |
| A0A5C7PYS6 | 16-158 | None |
| A0A5C7PLZ2 | 49-213 | None |
| A0A368TTD8 | 2-136 | None |
| A0A653QTB6 | 2-87 | None |
| A0A0F8VTR9 | 1-88 | None |
| A0A3A4K8W9 | 105-278 | None |
| A0A1L3ZS71 | 15-143 | None |
| A0A4Q3KTJ7 | 3-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.