DPCstruct | MC36918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 13.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R1BBJ7 | 44-169 | QNISVQYFSDAISAKKYSNNLSQEGWKAINFTPSRYKQLPADRYHNHHFDTAHDVIGQEFDNVIAFLDHTFYHTEEGKLFTRGFSPY… |
| S2Y534 | 2-111 | QLIDLYNEKGYIFISYTKSMYYSNSIDLYPNTYDTHHVIGQEYDKVMIMMDENFRYDQERRIQGKEHPNPDLLFYKLLYQAISRARE… |
| A0A098Z5H8 | 12-134 | None |
| A0A081QYD8 | 327-483 | None |
| A0A519THU3 | 1-127 | None |
| A0A823WJ84 | 227-350 | None |
| A0A290QAP0 | 386-507 | None |
| A0A0Q9YGB7 | 1-139 | None |
| A0A6G4N821 | 1-99 | None |
| A0A7V6W2D3 | 147-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.