DPCstruct | MC36914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 131 ± 16 aa |
| Standard deviation of domain lengths | 16.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4ZP01 | 30-159 | TAIVAPWTAEFIDPLLRASAQAAAKQCTGGPDGTSCGLRWIDNGRNDGSFGVGEQMAALEIVQSLLHSTVGGPATAQAGGISVSNPT… |
| A0A3N4LI89 | 1-140 | MTVQMAPFTQDYIMSKLRMTAIAAAKQYDGGDNRRTCGMRWTVSTCDGSFKVGLLGQTLPALEVIQSTLILSAPAPVTATTGGTSKG… |
| A0A4U0XV69 | 81-241 | None |
| A0A094FN96 | 327-441 | None |
| A0A0G2GBE7 | 215-350 | None |
| L7J3C3 | 494-623 | None |
| H0EUH5 | 70-202 | None |
| W9X139 | 1-107 | None |
| A0A6V8H8R7 | 2-132 | None |
| W9ZAM0 | 60-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.