DPCstruct | MC36912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 154 ± 20 aa |
| Standard deviation of domain lengths | 19.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A285PGM6 | 1-184 | MERKRQLLRLGVATLIATACILPTGVQAAELRYGSDQCFIRTYNKAHLAKNPAQQVTQIRFVHRPSAYNFDEAALSQGQGGRVKEQV… |
| A0A3S8U1H2 | 7-129 | TCYARDYSAAHLADHPAQRVTSIALTPADGTGTDPRLQLWVTLTVKDWPGEHLLALGYCENNGADTLYCGMEGDASGFTVTPAKGGA… |
| A0A178I5G9 | 1-155 | None |
| A0A7Y4HA76 | 92-231 | None |
| A0A258A826 | 2-171 | None |
| A0A2T7UV26 | 1-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.