DPCstruct | MC3691
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 157 ± 20 aa |
| Standard deviation of domain lengths | 19.92 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G7ILY8 | 4-164 | ETELQRHLDIFALSLSLKKNNRWSPEDDKVNYPLLFSIYIKMIQQDEQEFFVRKQDKLKMIQSLNRSKDFYSFTRHTQLFHTLKRMI… |
| A0A5N0Z394 | 12-194 | SEQYGTSLIQLFVQLLNLMENNSPLSEYHFYKPNIELFSLYQDYLTLNEAKYQASDVSMLKRSLENSLYASIEPNLLEIEIHELKPN… |
| I6T9M6 | 7-139 | None |
| A0A1V8YDK9 | 33-173 | None |
| A0A7K3JCV9 | 7-166 | None |
| A0A7K3JCE2 | 2-164 | None |
| A0A4U4EBV0 | 30-204 | None |
| A0A6L4LD76 | 1-154 | None |
| A0A7U8INZ7 | 25-170 | None |
| A0A1L8WS46 | 2-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.