DPCstruct | MC36909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 113 ± 17 aa |
| Standard deviation of domain lengths | 17.29 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01155 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G8CCK5 | 2-93 | VEVIHLDVGRFTCVEPDQLVTTYNAAVQGTWLDGSRLTITDIPFVGCCVLCKSSYSPTPENAYRSPCCDHPLEDILSGRELRIRSID… |
| A0A7W3MTK1 | 2-115 | HEMGLCEAIVDAVLLRAEGRRVRAVRVRVAGHPVVREVVDQGFALAAAGTVAEGAELDLVVEPPGVVCRLCAEWSPVTTARALLACP… |
| A0A2C6M9S1 | 1-89 | None |
| A0A2S6HF68 | 84-194 | None |
| A0A832G2R3 | 31-143 | None |
| A0A6B2YJQ5 | 1-119 | None |
| A0A7M3M5L5 | 1-123 | None |
| A0A559QJ17 | 20-155 | None |
| A0A3N5E989 | 80-207 | None |
| A0A846NYZ9 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.