DPCstruct | MC36903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 176 ± 19 aa |
| Standard deviation of domain lengths | 18.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7CW73 | 186-348 | GSHGGLGGSHGGQGGSHGGLGGSNGGQGGRHNVGHPTGCPGCGCGGCGDSCGWCGGNYGRRKRSVDGLAQSVDVQNLFDAISSEDKD… |
| A7TZ33 | 1-185 | MAAGGISSGYGAPSSRRSWRWYVSLGYAAPSSGGHGGGSVSSGYVAPSSGGHGGGSVSSGYAAPSSSYSRSSHYGKRSAELPRAIVP… |
| A0A7R8D6C5 | 1-179 | None |
| A0A7R8D6A8 | 1-200 | None |
| A0A5B7I110 | 100-287 | None |
| A0A553NU61 | 11-186 | None |
| A0A1D2ML20 | 81-215 | None |
| A0A553PG03 | 19-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.