DPCstruct | MC36902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 82 ± 14 aa |
| Standard deviation of domain lengths | 14.12 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14949 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6HII9 | 26-96 | KKNQMYDELGLYLENSNDICDCLSMNCPGCHFPCTKCGSEKCGQECRCCRRYIFESIEIEGTKTVVQFPEE |
| A0A7R8HCR7 | 268-364 | SNDGSSRRKDEEHSRVRRNLTRKSYFPVPKKGNVYDDKGLLVWNKLDLCDCFDHECSGCHFPCPKCKSPKCAHECRVNRRWQFETRE… |
| A0A183NPN8 | 19-108 | None |
| A0A226F4V0 | 110-195 | None |
| A0A164ZH55 | 34-120 | None |
| A0A6A5DE36 | 445-502 | None |
| A0A1A9XQS2 | 136-232 | None |
| A0A6S7GDD2 | 66-138 | None |
| A0A2G8LPP2 | 345-416 | None |
| A0A6A7FZ54 | 441-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.