DPCstruct | MC36900
Metacluster Properties and Pfam Annotations
| Number of structural domains | 127 |
|---|---|
| Mean domain length (aa) | 144 ± 35 aa |
| Standard deviation of domain lengths | 34.77 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 87.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.98 |
| Pfam Score | 81.35 |
| Assigned Pfam label(s) | CL0209- CL0369- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8GYY3 | 743-866 | ESWNYWDAVSSLGVFIDSEGHLKLDTIKVFARPYPQATNGVPKFLKYDPFTGDFNYRFLAKDSMNQVPTEIVIPKFAYENYKYKVTL… |
| L8HC21 | 1-79 | MNFDPETGVFQLTYILNLKVSQPTEIYLNEEYYYANGYVVSVVPSQIVQAKSPGKNLVWVYALPTATDGATITVTISPK |
| A0A0S4JNZ0 | 275-374 | None |
| A0A498PFB8 | 10-185 | None |
| A0A183MAN9 | 34-192 | None |
| A0A0B7NAD8 | 515-693 | None |
| A0A522UEV2 | 2-117 | None |
| A0A1V6HQM6 | 351-495 | None |
| D0MUI9 | 25-142 | None |
| A0A1V6HC21 | 547-674 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.