DPCstruct | MC3690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 96 ± 6 aa |
| Standard deviation of domain lengths | 5.66 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537YIR3 | 65-158 | GNPKVQRWAIEVLSSAIERYGLEWVKWDFNTDPAPVWKGDAAREVAHVRGVYTVMEQVRRRHPEVWLEMCAGGGNRIDSEMIRRADS… |
| A0A832ET35 | 151-242 | VVAHADDVLDRLVRQYGVGYIKMDYNINAGVGTDYAATSAGDGLLEHNRAYLRWLDQVLARYPDLVMENCGSGGLRMTYGLLDRLSI… |
| A0A7X5HZC0 | 183-283 | None |
| A0A847YHG1 | 144-241 | None |
| R7IMG8 | 431-529 | None |
| A0A1Y4TBS5 | 266-358 | None |
| N1Q5K0 | 120-213 | None |
| A0A645CKY1 | 10-101 | None |
| A0A2H3IGU8 | 39-130 | None |
| A0A7S3HNU4 | 13-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.