DPCstruct | MC36892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 218 ± 40 aa |
| Standard deviation of domain lengths | 39.98 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y5EJH9 | 4-240 | NNTIYKFHVANLHSIQTAIEHLKRTIHVAIASENKKLILSYTRLLSLTLGAWAEVRLNKLLYETEGFSTEEREKIKAKGSQFEKWEL… |
| A0A5C8QN19 | 3-244 | MMDRVKRNKVHRKNLKTVELAFNSTSLAAKDAIRRRDLRQQKLLTLNSAFLLGAIMENRLMAAISEPRLDEKRELRILRASSVNDMW… |
| A0A2S6HZP0 | 13-230 | None |
| A0A4Q7C8W9 | 3-135 | None |
| A0A5P5ZML1 | 79-301 | None |
| A0A1Q6RTI9 | 1-168 | None |
| A0A7W1SYW8 | 2-179 | None |
| A0A7L8V3T3 | 3-183 | None |
| A0A428AST1 | 2-191 | None |
| A0A853RI00 | 2-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.