DPCstruct | MC3689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 173 ± 35 aa |
| Standard deviation of domain lengths | 34.91 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.72 |
| Pfam Score | 96.67 |
| Assigned Pfam label(s) | PF05866- CL0493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377L955 | 6-215 | QKYLMGPMGKIAQFKIVRAVMAAGMASIPFTIVGSMFLVLNILPLPFPFLEGFFNSTFFKVSDLYMIVNTMTMGILSIYFAIVFAYE… |
| A0A6D0EJ83 | 2-173 | GAFSVLISNMVLDPKNGLASFQSLSFLAALKPITSALNYATLNFLNIGAVFLIGVELGRINGIKSLFPGLLAVICFICVTPTTVEML… |
| A0A0R1SE22 | 3-192 | None |
| A0A0R1PR97 | 3-115 | None |
| A0A2X2V7V8 | 5-144 | None |
| A0A7H4SF33 | 12-129 | None |
| A0A7H4MPS1 | 7-200 | None |
| A0A7H9E2S8 | 15-257 | None |
| A0A0R2D972 | 16-134 | None |
| A0A143WWV0 | 116-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.