DPCstruct | MC36889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 102 ± 6 aa |
| Standard deviation of domain lengths | 6.34 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L9ZEN7 | 5-95 | KLKKIIAKKDISSLLNNLITSLGGDISIQDIDEQLLFGDEPDDSSGKYKIDVKGSTLGWVRGGENARPIAALLNYLANRELERRAIA… |
| B1X306 | 24-128 | LKEIIDDFEIKSLLSDLIHLIETPVSIEDVNGHLLLGEFIINSTAEYLIIADQQPIGSMKGDSSTQIIARLLSYLANQENLVFFDDL… |
| A0A1C0VF44 | 5-105 | None |
| A0A519BBZ3 | 2-109 | None |
| A0A846E570 | 3-112 | None |
| A0A1I4BWX1 | 3-114 | None |
| A0A5J5IM50 | 5-103 | None |
| A0A651EMG2 | 3-102 | None |
| A0A537KKC4 | 6-103 | None |
| A0A1J0ABK8 | 15-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.