DPCstruct | MC36883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 143 ± 8 aa |
| Standard deviation of domain lengths | 8.06 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446JX19 | 185-325 | MLLLGGSAVVHALTGVNVYAASFLIPLGVIVYTFAGGLKATFLASYIHSVVVHAVLLVFVFLVYTSSSSLGSPKVVYERLLVVASAA… |
| G3JTC7 | 165-307 | LLGASAAISALTGMHIIAATFLLPVGVIMYTFVGGIKATFLTDYFHTFVITLIVCFFTIKVWLTPEISSPGALFDIITQLAVDRPVA… |
| A0A4T0WBY7 | 89-239 | None |
| A0A1L7XAV6 | 75-204 | None |
| A0A814KJM8 | 1-136 | None |
| A0A0G4MZB6 | 534-679 | None |
| A0A2H1G664 | 1-147 | None |
| A0A7J7G5P3 | 612-769 | None |
| A0A0K3C749 | 66-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.