DPCstruct | MC36880
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 141 ± 21 aa |
| Standard deviation of domain lengths | 21.10 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F1LA28 | 5-135 | WDYLMRQRALKRPIAPHLTIYKPQMTWMVSGLHRVTGCAMAGTLLIGGVGFSVLPLDFTTFVEFIRGLGIPWVILDTFKFIIAFPIA… |
| A0A0B1PNR2 | 34-170 | WAPLASNVKTPIQAWGWDYLQRQKSLHRPIAPHLTVYKPMLTWMLSGLHRITGVAMGTTIAILSVGLLVVPFDFTAMINFIRDLHLP… |
| W4GL90 | 15-152 | None |
| A0A3M0IZS6 | 109-197 | None |
| A0A225AUI7 | 357-522 | None |
| A0A2H9TMT1 | 147-295 | None |
| A0A7U7KIB0 | 20-162 | None |
| A0A2G5USG8 | 56-207 | None |
| K3WV26 | 13-128 | None |
| A0A2U3VB94 | 2-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.