DPCstruct | MC3688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 114 ± 20 aa |
| Standard deviation of domain lengths | 20.35 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.46 |
| Pfam Score | 94.49 |
| Assigned Pfam label(s) | PF12597- CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P9XX10 | 9-141 | TPADAAAAPDAATPAQPQQSQPATLSEALRNVSLDRMRHVVRTPCGRDSLLYGIGGGTAVGIARFLITRKVLPSANWAVGAFALISI… |
| A0A6V7I2I0 | 19-102 | KQEPIFLLGRDITKVACFKPSMITGMLSGAAGGILTFMFTSKPNLASHTMIGSFIVMTMGYYGVCRYQFAKEMMMVDKMKGLMQ |
| W6MR44 | 25-171 | None |
| G0S2Y6 | 1-155 | None |
| A0A1E3NHX2 | 10-168 | None |
| Q6DH88 | 1-103 | None |
| A0A0B7N5M7 | 1-98 | None |
| A0A1V8SR66 | 3-125 | None |
| A0A674GT79 | 360-471 | None |
| T1HCK4 | 10-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.