DPCstruct | MC36879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 115 ± 12 aa |
| Standard deviation of domain lengths | 12.34 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.47 |
| Pfam Score | 91.43 |
| Assigned Pfam label(s) | PF08685- CL0692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2BBJ3 | 117-231 | GPITCLEIQRRFRTNIDGEYSLLIGGKNMTIYCHGMSSAEPREYLTLPAGDSENYAEIYDKRLKNPHVCPFNGQRNDSCNCVSEFGT… |
| A0A0B1PHY8 | 1-148 | METAARYQISQKGPKNCYELRQMRNTSADGEYTIWARGSALRIYCYGMKNLYPKEYLTLQTDPLSNFAEFYGKRLLNSASCPYDGKR… |
| A0A564XZT5 | 157-280 | None |
| P59511 | 1703-1811 | None |
| A0A7R9FRD4 | 934-1044 | None |
| V4B3P1 | 122-222 | None |
| V3YY07 | 61-158 | None |
| A0A6P4Y6I1 | 799-910 | None |
| A0A182TA98 | 44-162 | None |
| V4BB52 | 4-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.