DPCstruct | MC36876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 528 ± 153 aa |
| Standard deviation of domain lengths | 152.59 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.62 |
| Pfam Score | 77.73 |
| Assigned Pfam label(s) | CL0580- PF14641- CL0198- CL0541- PF09371 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A085NV13 | 115-630 | SLRPHQVMAINRGVKRKVLKKQFTVPQSWLSEFLAATAKLMGKSGCNEAKAFVANCTKTCYTKVVRPRLVSRLWNKASKLARIHAVE… |
| A0A6I6D5R9 | 142-709 | AEQYLNENVTSVEDAVNGALDIIAEQVADNATVRGFIRKLTLAKGILVTKAKDENNDTVYSMYYDYSEPVSKLPPHRILAINRGERE… |
| A0A7S2A5F9 | 6-503 | None |
| A0A518BGA9 | 382-925 | None |
| U7PWQ2 | 715-1236 | None |
| A0A5B6V611 | 75-628 | None |
| A0A6V7XC82 | 2-636 | None |
| C1MUJ5 | 4-502 | None |
| A8J804 | 314-819 | None |
| A0A396H2J9 | 13-373 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.