DPCstruct | MC3687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 180 ± 11 aa |
| Standard deviation of domain lengths | 10.82 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.30 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF20946- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9CDN0 | 3-165 | KPVLSILELSFPLASSDLGASSLENEFMMRKLHLSQIQKKMEEMAALGLDTTAFDDEAFNTEAALDRCILRLISSCCSGDKLVRATE… |
| A0A4P9XV68 | 1-194 | MGFALQGGRQYPSFSRPVISEFELRIPILPWDSGEMEQEEKLLRMRTLSTVDLGLMDAATSSRSQASMDKLVLSMVQLACKADKSQR… |
| A0A453KI30 | 62-240 | None |
| A0A1I7XLW3 | 1-174 | None |
| A0A2G4T8Y1 | 1-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.