DPCstruct | MC36866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 116 ± 22 aa |
| Standard deviation of domain lengths | 21.64 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 93.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6N9F2 | 1-97 | DLEIPAKYGIEQGVGDTLGPGGIFYGLKNASAIVDIAHDMEEESPNALLINYTNPMAIASWAVSDPTKVKYVGLCHSVPGTARTLSL… |
| A0A0K2REI7 | 37-183 | SAIRVGGLEGRAADERIALEHGVIGQETVGAGGISYALRTIPVVLDIAESVKKHAPHAWFINFTNPAGVITEVMTRVLGNKVVGICD… |
| A0A0C7R3V1 | 81-203 | None |
| A0A398CTG5 | 81-220 | None |
| A0A3M1IVK4 | 34-145 | None |
| A0A0B8QJ83 | 65-183 | None |
| A0A2M7KJI3 | 2-111 | None |
| A0A497JVN2 | 59-134 | None |
| A0A7K4H5M5 | 9-104 | None |
| A0A7C3XL08 | 68-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.