DPCstruct | MC3686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 7.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 65.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H9THA1 | 50-130 | LSDDEIEIVLNAPTRPTIDLTTPGTLNGVSILETDLESFEDRPWRKPGADLTDYFNYGFNEQSWRVYCGKQKGLREQPVMP |
| A0A4P9XS88 | 1-72 | MTVSSTSAVKAGTVDLHAVGELNGKPIFDVDTDSLEDRPWRKPGADLTDYFNYGFDEITWRMYCARQKQMRE |
| A0A2T0FI30 | 53-129 | None |
| A0A1S3L1Y6 | 61-127 | None |
| A0A183BK39 | 61-138 | None |
| A0A2P7YQL4 | 92-177 | None |
| G0W9A6 | 159-241 | None |
| A0A0F9YW66 | 1-85 | None |
| A0A183HZY8 | 60-156 | None |
| A0A510PB40 | 104-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.