DPCstruct | MC36859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 147 ± 20 aa |
| Standard deviation of domain lengths | 20.03 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0142 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2VKI2 | 5-130 | LEPRGQQSRAMLWCSPLLAAVLTLVCGSLLFIGLGLNPWVTLHTLLIAPVSDWYGLSELMVKTLPILLCALGLAVAYQARIWNIGAE… |
| A0A2W4KKR3 | 2-140 | NPVLRLLLQAAVPVAALLLATVIGAGVVLLAGGNPGEVLGILISYNLSTPDSIASVLSRTVPLIFSGMAVALGFRAGLFNIGVEGQY… |
| A0A6G2CI75 | 15-160 | None |
| A0A426DLI8 | 33-162 | None |
| A0A535QJD4 | 16-182 | None |
| A0A7V4J4S4 | 5-155 | None |
| A0A537ZKP1 | 25-156 | None |
| A0A6B1TLL2 | 10-151 | None |
| W4LXA2 | 5-139 | None |
| A0A535FLB6 | 36-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.