DPCstruct | MC36858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 130 ± 15 aa |
| Standard deviation of domain lengths | 15.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6FYM3 | 1-133 | MNIYIWQICEYKGALYVTTLDHGSNIQTILEIFLLNKEALKKIIPAMKLEGISVEGIIKYCEKTLKELKDTNYQFGFDIFMSTDGIR… |
| A0A2W4JVW8 | 1-132 | MKQFGNKLYLGTWDWSVLLQPLFSSLVTNNKRVLPAVLPWFINPVNIINLAREYNLKPLLKLLKSSKRNFCENQGFDLYVSENGENW… |
| C4REY9 | 306-451 | None |
| T0CLP4 | 74-232 | None |
| A0A1Q7HWJ1 | 371-486 | None |
| A0A7X9AGY3 | 50-171 | None |
| A0A645DF32 | 183-313 | None |
| A0A7C4ENR4 | 40-169 | None |
| A0A7X6ZEN3 | 109-244 | None |
| A0A7X9S4I3 | 212-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.