DPCstruct | MC36852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 203 |
|---|---|
| Mean domain length (aa) | 91 ± 20 aa |
| Standard deviation of domain lengths | 19.71 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 34.12 |
| Pfam Score | 97.01 |
| Assigned Pfam label(s) | CL0023- PF08352 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1HD70 | 2-85 | EIGTSRQITNAPRHPYTQTLLAAIPEPDPSKREIETNVEGETDEIKERPKGCVFYRRCPIAEDICATEEPQLREIGENQKVACH |
| A0A1M4PMV1 | 2-81 | YLGNIVELTDYKSISTDPLHPYSQALLSAIPIPKVGLKGERIVLEGDVPSPIDPGPGCVFYGRCRHRKDICKEAKPKFEE |
| U1R0J9 | 1-72 | None |
| A0A3M0NJ55 | 17-107 | None |
| A0A6L3EXC5 | 70-165 | None |
| A0A1X7PV66 | 447-545 | None |
| A0A7Y3NH26 | 36-134 | None |
| A0A537MQG1 | 57-164 | None |
| A0A3E2YSM5 | 112-197 | None |
| A0A7C1DV65 | 7-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.