DPCstruct | MC36851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Standard deviation of domain lengths | 8.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212DVC3 | 1-71 | MKAEDIETLSIHPAIGIARVGNAPDDYFLAAEVRGGTPQDAQDFRDSQGRIKRQGARFRVYAKQSLAKSVR |
| A0A7W7Q8B2 | 2-72 | TITAVTVHPAIGIARVGNSPDEFFIGPERLWAPPDPVGGFKDARSRVKRQAARFRLYAHHDDGTVTELTAA |
| A0A6P1BJH9 | 12-74 | None |
| A0A7D5REM9 | 1-88 | None |
| A0A6J7ECX7 | 36-112 | None |
| A0A137QIZ2 | 20-102 | None |
| A0A059VBI8 | 2-71 | None |
| A0A099Y2S0 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.